Would you like to draw me, here are some pics
of me! Also check out my other slideshow
videos for more pictures! :) Tags :PicturesDrawMePleaseSlideShow
What do you do with fresh McDonald's French
Fries and 10 packets of Ketchup? You paint
with them of course. 50 min speed painting
plays in 4 mins. Ketchup as paint and french
fries as a paint brush.
I had to remove the original song because of
copyright infringement. Unfortunately the
YouTube AudioSwap beta also reduced the
quality of the video. When I get a chance I
will upload a new higher quality video. I am
also in the process of having some limited
edition posters and artist prints made. I
will be selling these prints on ebay to raise
money for the CARE World Hunger Campaign.
Please check out my other videos where I draw
with more traditional mediums. Coming in
April I am starting a series of instructional
videos on how to draw portraits. I am also
holding a contest on YouTube soon to win your
own portrait. So subscribe to my channel to
keep updated.
Now to answer some questions..
The painting Measures 14x11 inches on
foamcore surface. It is not permanent the
video is the art.
I do custom portraits in a variety of
mediums. You can find some info at
http://www.EclecticAsylum.com Tags :speedpaintingketchupcatsupfrenchfriesdrawingtimelapseeclecticasylumsupersizememcdonaldsmcdonaldmickeylost
lets try to beat EclecticAsylum in what he
does the best of all: drawing!!!
Is it possible to draw something better? Your
opinion will decide! VOTE! Tags :artartistdrawingpaintshoplittlelocaEclecticAsylum
büyük şehir belediyesi bakırköy
belediyesi kültür sanat ile ilgili
çalışmalarını sanatcıları arasına
alarak yapmalı resim dersleri bakırköy
kültür merkezleri atölyeleri sanat
çalışmaları carusel alışveriş merkezi
arkası zeytinlik mah dadyan sokak no 3
capasity alışveriş merkezine 30 adım
irtibat 05384244231 nilüfer hanım kara
kalem portre ressam grafik eclecticasylum
art korkunç kazalar şakalar gol komik
dizisi draw müzik çizimi kara kalem
portre çizim cizenler Tags :karakalemportreressamgrafikeclecticasylumartkorkunçkazalarşakalargolkomikdizisidrawmüzik
Long before the monkeys were fixing problems
at YouTube they were teaching bicycle safety
at schools.
This is an old clasroom teaching reel from
1963. This was before LSD but... What were
these people thinking when they made this?
I collect old reels and I'll upload them as I
get a chance.
This is certified public domain by The
Library of Congress and Creative Commons Tags :bicyclesafetyfilmreelmonkeysbikeweirdyoutubeclassroomteachinghowto
A tribute I made to EclecticAsylum, but
changed to accomidate my skill, or lack
thereof.
Actually, I did it to suck up to him so he'd
draw me. Evryone like a poser, right?
Right???
Oh, and here's a link to the music file, for
anyone who wants it:
http://www.albinoblacksheep.com/audio/blackbe
ard Tags :drawingthewinekoneportraitmarkerstimelapsespeeddrawarteclecticasylumjasonbaalmaneclecticpopularpop